DPCstruct | MC15428
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 120 ± 14 aa |
| Standard deviation of domain lengths | 13.92 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 36.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14577 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A059B488 | 251-358 | QELLELYTSYKQFGGFAVIARGSRVVVNTRLRDFETVLSQHQMWVIPAQPFEAIFKKYYDEVVRKPRCHHFYIPGVVGSIPECIKCA… |
| M5XRR8 | 8-116 | KQADLATLEIQKLLSYKNESGWAVLSKGSSLVVAGHGISILKVIEDFDKWKGQVREKGFEFCFTTYHAKIRLTPCCRLDIPGSTGKV… |
| A0A6N2NJX7 | 558-709 | None |
| A0A2P5ECP3 | 516-631 | None |
| A0A2P5BWR4 | 40-184 | None |
| A0A5N5LR47 | 392-493 | None |
| A0A540MQY3 | 277-391 | None |
| A0A6J1BZ70 | 345-468 | None |
| A0A314YA15 | 42-160 | None |
| A0A7J9DN89 | 52-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.