DPCstruct | MC15427
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 161 ± 10 aa |
| Standard deviation of domain lengths | 9.53 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 74.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 26.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W6S5T0 | 2-167 | IMMMLMLMINNLILFSSHPLMFTLMIIIQTLLVSLMLGNISYSYWFSYILLLVFLGGMLVIFMYITSLASNEKFKFTFKLPKLMMIM… |
| A0A0S2MR68 | 1-164 | MIMPLLLISLLNSISFILLSHPLSMGLLLLIQSITISLIIGFITYNYWFSYILFLIMIGGMLVLFIYMTSVASNEKFSFSKKIMLLS… |
| A0A0S2MRT2 | 1-148 | None |
| A0A8B0R7A3 | 13-185 | None |
| A0A3S8V0I7 | 49-201 | None |
| A0A4D6TNZ7 | 2-148 | None |
| B6RQY9 | 10-183 | None |
| A0A1P8DKJ1 | 25-181 | None |
| A0A7H1KHT7 | 1-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.