DPCstruct | MC15422
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 69 ± 7 aa |
| Standard deviation of domain lengths | 6.67 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 52.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04800 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182FHE4 | 607-673 | DLSPISGVPEEQLKERRVRIFIPAKNAMQSGTDNIHHWSIEFDNRERWENPLMGWSSTGDPLSNLRV |
| A0A016VNE9 | 10-75 | VPVPVLQDEAVDIGGRPPEHAEERTARIFRAAREATQSPWNNTKAWHIELDNRERWENPLMGWSST |
| A0A084WEE3 | 640-706 | None |
| A0A7R9A7N9 | 639-714 | None |
| A0A7R9PTB3 | 1-62 | None |
| A0A0J7KSL9 | 57-118 | None |
| A0A482WF30 | 474-536 | None |
| A0A1V4KRU5 | 352-432 | None |
| A0A482RQE2 | 3-72 | None |
| A0A820QQT0 | 528-601 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.