DPCstruct | MC15420
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 58 ± 6 aa |
| Standard deviation of domain lengths | 6.23 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 71.08 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | CL0167- PF17219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L8SR62 | 1-55 | MGDKKSPTRPKRQPKPSSDEGYWDCSVCTFRNSAEAFKCLMCDVRKGTSTRPRLK |
| A0A016VBN0 | 1-53 | MSGTGKKRVRKEDVTTFDECDAGSWECTVCTYRNRFEAFKCEMCDTRKGTSTR |
| A0A1B6GKH3 | 1-60 | None |
| A0A2K5KAL3 | 1-51 | None |
| U4UU28 | 52-107 | None |
| A0A3M0JDI1 | 1-56 | None |
| A0A6I9KGC3 | 263-333 | None |
| A0A665TME6 | 1-55 | None |
| A0A6J1XGU3 | 7-59 | None |
| A0A4W5L5Y9 | 1-50 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.