DPCstruct | MC1542
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 172 ± 39 aa |
| Standard deviation of domain lengths | 38.66 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 73.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A371CZZ4 | 20-189 | ISLVLASVKAEKVKTEKEVKAEKKVKTEKKVKEEKTKKSAHTVKKEKMLYPEKGSAIIRNSKKRTHWFKSVFHKALPKPPMELKPRP… |
| A0A5B1RBZ2 | 2-111 | PQRLVRRTRRFPAGTGEGSTSWYCTEGNANIPVPPDGLRFVEVADIYVHRNVETGRSQLWCFNKEQCWQPTYVGGEHPLLVGRRLQL… |
| F8NTV7 | 335-515 | None |
| A0A165Y6S3 | 178-297 | None |
| A0A165WKH5 | 46-231 | None |
| A0A5C2STR8 | 134-336 | None |
| A0A369JIA9 | 15-165 | None |
| A0A5C2TCW7 | 289-501 | None |
| A0A1J8PVI1 | 266-441 | None |
| A0A5C2T077 | 122-315 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.