DPCstruct | MC15419
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 192 ± 24 aa |
| Standard deviation of domain lengths | 23.71 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3E6T9 | 41-185 | STIVKSFVDTGLGRRRRAKLLSECEDDLACDVPYSMHRKNRWAECNAPALLGDGGEELAIAVVERTAAKKGTRLVNAVHYVDREGSR… |
| A0A016VAJ2 | 82-242 | PPAFIVKQIDDPAKVLGKRRKARVLHACSDTYAPGLMYSMDKKNRWSQVDAATLLNGVNNDEVSGQVVELRTFGPACHWRDSKVTAL… |
| A0A0K0E5P5 | 30-230 | None |
| A0A0B1T749 | 1-207 | None |
| W2SQ54 | 26-227 | None |
| G0PM14 | 55-223 | None |
| A0A0N4XQ70 | 1-191 | None |
| A0A016WLD3 | 31-206 | None |
| A0A1I7XM87 | 33-227 | None |
| A0A1I7TLM4 | 3-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.