DPCstruct | MC15417
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 57 ± 4 aa |
| Standard deviation of domain lengths | 3.60 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 63.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A816LQH2 | 111-167 | ECTVMGVPNISTNLSGFGCFMEEHVTEHQTYGIYVIDRRHQSANDSCQQLAQYMYDF |
| A0A016VA70 | 1-66 | MLQVRGSTECTVMGVPSVTTNLSGFGCFINEHVADAKSYGIHVVDRRFKGADESINELADGLYEFT |
| A0A671VXY0 | 426-482 | None |
| A0A2H1BS47 | 27-78 | None |
| A0A0B1RUD5 | 1-54 | None |
| A0A0B1SET7 | 1-53 | None |
| A0A3P6RE20 | 1-53 | None |
| A0A183H718 | 168-224 | None |
| A0A1Y1WS77 | 1-53 | None |
| A0A368GG93 | 307-374 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.