DPCstruct | MC15416
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 68 ± 6 aa |
| Standard deviation of domain lengths | 6.09 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 55.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0104 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401KXC4 | 454-518 | LQKYNILIDFDEGGYLLQIFTKHVVDRPTVFLEIIQRENFDGFGAGNFKSLFEAFERDQEMRGNL |
| A0A016V821 | 2-68 | AKLRELCILMDFDDNGYLLQLFTKPVQDRPTLFIEIIQRRNFNGFGAGNFKALFDAVEREQKLRGTL |
| A0A1C9VK61 | 1-56 | None |
| A0A3L7N588 | 636-702 | None |
| A0A6A4WRH0 | 812-878 | None |
| A0A1L8HQR1 | 188-259 | None |
| A0A0L7L1L2 | 179-245 | None |
| A0A7W0WAI9 | 195-261 | None |
| T2JPV5 | 12-90 | None |
| A0A1Y3BP77 | 39-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.