DPCstruct | MC15412
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 193 ± 27 aa |
| Standard deviation of domain lengths | 26.82 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06992 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A455VQT5 | 3-146 | QVDAGMRIARRQERPFLPSPGQFVAWCKQSGGALGITVDQVIAEYWDWRNRSFEFISSEQFPWSQPVMYHICVELRHRSTERQLTNG… |
| A0A482NP89 | 8-178 | KQAWPDKEATNAAKATWTKAFMAEKITTIEQIRFGIERCRKLGSDFAPSVGKFINLCQPTPEMLGLPPLETAFREACRNVHPSMAGQ… |
| A0A2A5BVI5 | 3-130 | None |
| A0A263HF86 | 30-245 | None |
| A0A7H4MSJ7 | 271-488 | None |
| A0A1I1E134 | 21-219 | None |
| A0A202B2W6 | 6-212 | None |
| A0A839IMR9 | 80-285 | None |
| A0A5E8R2W3 | 2-173 | None |
| A0A516SEX9 | 2-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.