DPCstruct | MC15411
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 268 ± 34 aa |
| Standard deviation of domain lengths | 34.18 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 66.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0018 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I8P469 | 132-362 | LAPHKCPEDPESDSGLSLNYSDAESLDPEAGVGEAGRGRPEYAELFPPAFPPPPPPPPPPPPAWASPPGPARPKPPGRGEAGCRDQR… |
| A0A3N0Y6D4 | 9-289 | KETGEFLPSPSSVNSQAVPFSETLPSRVSTQPSPVTQNPLLSALLFSKSQKPPSQEQAFSELLSLPDLQYYLDVLESEGSSLPLENI… |
| A0A3Q3VQG2 | 146-392 | None |
| A0A287A5D7 | 319-620 | None |
| R7V3M6 | 81-385 | None |
| A0A4W4HD58 | 1-314 | None |
| A0A4Y6GVA9 | 386-667 | None |
| A0A1S3HDZ2 | 356-587 | None |
| A0A2G8KR30 | 86-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.