DPCstruct | MC1541
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 164 ± 14 aa |
| Standard deviation of domain lengths | 14.31 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q2D1S0 | 488-648 | PERLIEHTDVVFTQAFNVQLSERGVVDSPRDLFEKFVAGRGIPNQQDLDNIIGNLSPLVDLNQSSSSTWRARMLTLAATGHPFLEEG… |
| A0A371CHX8 | 14-188 | CLEFRSNLGDPDANDPTLVDVHPADGDLVGTTTYDIDLLFEQVAAEALKRYLRGRGHPDHHILREMLGAATLERDHEDTLLRARLFL… |
| A0A5C3KEJ5 | 202-357 | None |
| A0A164SC62 | 998-1175 | None |
| A0A5C3PFU2 | 3-154 | None |
| A0A2G8SDG1 | 374-557 | None |
| S8F0J2 | 562-727 | None |
| B0D1P5 | 544-697 | None |
| A0A146I198 | 897-1071 | None |
| A0A401H1E0 | 347-486 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.