DPCstruct | MC15403
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 152 ± 13 aa |
| Standard deviation of domain lengths | 12.95 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 70.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.71 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 42.84 |
| Pfam Score | 80.00 |
| Assigned Pfam label(s) | PF10172- CL0306 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q2R486 | 23-183 | SEGGAAKFLSGLPSRGNFSSISASSTLGRLRVYVCEHDTDPPEGQVIETDTTNILIRHLQLKKKEMDAKEAKEARDAGSRNQGETVK… |
| A0A067EN83 | 14-162 | NQTASSFLANLPSRGLFTSAAFSPNQGGMRVYICEHDTSPPEDQLIKTNQQNILIRSLTLKKQKGDPSSKDVKGATVADRKRTAERI… |
| A0A7J7N2U8 | 33-196 | None |
| A0A445EQW4 | 172-326 | None |
| A0A396IGJ8 | 1-145 | None |
| A0A0D6R590 | 2-151 | None |
| A0A059CY98 | 67-222 | None |
| A0A7J7HWU5 | 67-216 | None |
| A0A087SN72 | 5-176 | None |
| A9RGW3 | 1-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.