DPCstruct | MC15402
Metacluster Properties and Pfam Annotations
| Number of structural domains | 83 |
|---|---|
| Mean domain length (aa) | 269 ± 59 aa |
| Standard deviation of domain lengths | 58.70 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 80.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.19 |
| Pfam Score | 83.00 |
| Assigned Pfam label(s) | PF04925- CL0042- CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H8TFF2 | 4-253 | EQRKSSQAGTEFLDFCDDHYLADLMTEPDGLKDVLNFKPFWYNTTCTLNDSQKNILKSLGNKEYLLSKDDKKSALLSLVDIIYAYCF… |
| A0A368H0W7 | 712-979 | SYGYGFAWKRKGILGQLSEEIGTLVELPDPEHSSIHERSKKCAEKDAKLDFLDPEDSLRHAIESEFDLPLDVDAEDRQRLKDFPKKK… |
| F0WR50 | 188-512 | None |
| A0A811MCC7 | 63-329 | None |
| A0A1I8IVG0 | 131-457 | None |
| A0A1I8IEJ1 | 432-706 | None |
| A0A7M5XGB9 | 2-216 | None |
| A0A2V2VI19 | 175-377 | None |
| A0A1Q9DYI0 | 338-601 | None |
| A0A2P6P3B8 | 4-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.