DPCstruct | MC15400
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 60 ± 6 aa |
| Standard deviation of domain lengths | 5.73 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 68.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2GRN4 | 1-52 | MVLVGTQDAISAANPRVIDDSRARKLSNDLKRCTYYETCSTYGLNVERVFQD |
| A0A368GYU4 | 1-74 | MNKFRNVADMPVLLVGTKDTLSEKNPRVITEEEGKQMANHLKRCAYYETCATYGLNVERVFKDGKSRPLRCRVG |
| A0A0D6LTK2 | 293-353 | None |
| A0A8B6EWE0 | 381-441 | None |
| A0A6G0YC88 | 42-102 | None |
| A0A3P7G0H2 | 1-59 | None |
| A0A3Q0IVY9 | 465-514 | None |
| A0A4W5KUT0 | 1-64 | None |
| A0A653CUV9 | 1-60 | None |
| A0A0N4SYC3 | 1-52 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.