DPCstruct | MC1540
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 97 ± 8 aa |
| Standard deviation of domain lengths | 8.39 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 24.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0643 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q4GF48 | 15-110 | VVAVRAVLRLEGSAEDALLGRVCATAILLCEAFVGGAIVARVAGDGAAETWDAVPAPVAQGVAMLAAHLFDHRESDALPPAAVAALW… |
| R6MYT4 | 12-98 | LITIEEIKQYLHLDDDSEDEYIHILIILAAEICENYTREILPEELPKSYKQAMLMIIGYFFENREGSKNGLPPAIFYLLAPYRKAVF |
| A0A756LA26 | 1-106 | None |
| A0A1X7N053 | 3-102 | None |
| A0A378A2K5 | 4-93 | None |
| A0A377ZGK2 | 63-169 | None |
| A0A7H9CKL8 | 10-100 | None |
| A0A6I2TX92 | 2-101 | None |
| A0A377LF73 | 118-208 | None |
| A0A6N3A707 | 2-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.