DPCstruct | MC154
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 122 ± 5 aa |
| Standard deviation of domain lengths | 4.70 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 80.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 45.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V1PDF0 | 7-137 | LAFLLRGFNGQWIEPVKCLDYISSSICSGILKVYGEDRCRIDFLFGRYQCCWTCAATLGIPIDSLGRFNDQQGFYFYHPGCPNNVRD… |
| A0A0V1FU89 | 1-115 | MKCMNYWPLSICENYINIYGKSMCTKNILFGRYQCCVSCAEVLKVTVNEDGTFESKDNFKFYDESCPEATDRMVAGNSWTPWCLAYK… |
| A0A0V0W9E6 | 824-947 | None |
| A0A0V0ZUI0 | 69-190 | None |
| A0A0V1NEB2 | 153-268 | None |
| A0A1Y3E9X3 | 20-141 | None |
| A0A5S6QYV3 | 58-176 | None |
| A0A085NPB4 | 59-182 | None |
| A0A0V1GQL4 | 13-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.