DPCstruct | MC15399
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 256 ± 19 aa |
| Standard deviation of domain lengths | 19.29 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7VYF3 | 14-248 | YFRLLGKEDDYGNSPLSSLMDLWIIPKLHFSVHNTIIDLIHYIISPQGDTEDNTNGIDLLSTFMPRILQILQNKLTSRKSLSRKELS… |
| A0A368GYL0 | 1-278 | MVVPYLADAKSNRDEPIVVAPLSVIKMLATVCAYPSHYHILAVRFNRNDHNGALMELLVSPLSWPGMTPHMLNIIRKALLNLLTLAD… |
| A0A392M493 | 26-265 | None |
| W2T080 | 104-359 | None |
| A0A368FIH1 | 2-215 | None |
| A0A0R3Q6A8 | 43-313 | None |
| A0A7F8QF03 | 2-268 | None |
| A0A0C3D7B3 | 93-360 | None |
| A0A498SG42 | 130-393 | None |
| A0A7R9PFL7 | 9-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.