DPCstruct | MC15398
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 128 ± 25 aa |
| Standard deviation of domain lengths | 25.05 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P5JR21 | 270-378 | IAGSLAVELMVSVLQHPEGGYAVASSSDDRMNEPPTSLGLVPHQVRGFLSRFDHVLPVSLAFDKCTACSSEVLDQYEKEGFNFLAKV… |
| A0A368GYI8 | 9-130 | SMIASGVAVELLSSVLQYPDPLTTPANIGEPDDSSSLLGATPHQVRGYLSRFSQMTPCVRRFEKCVACGTTVAEEYVASGAEFVKEV… |
| A0A0N4TMR8 | 971-1087 | None |
| A0A060S7Q8 | 406-519 | None |
| A0A5J4X2A3 | 329-433 | None |
| A0A4R0REZ1 | 25-140 | None |
| A0A7F8QUJ1 | 319-408 | None |
| A0A7S1N9L1 | 6-112 | None |
| W2JHL1 | 475-628 | None |
| A0A835TRS6 | 524-690 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.