DPCstruct | MC15395
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 228 ± 31 aa |
| Standard deviation of domain lengths | 30.56 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.96 |
| Pfam Score | 86.35 |
| Assigned Pfam label(s) | PF10228- PF10283- CL0237- PF00173- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4C1SXU3 | 1-194 | MPSDFYIFFEKLKEDGSIEEILSSVNLQLIGPYDLLLGKLPMIEEKELYLIHWRFFYDPPEFQAVLKCKGKSQLHFGYFRDNPNEAP… |
| A0A368GRP2 | 303-504 | AVKETNSHGRAVKKAPVLKENGRTEQSNAAVFCDATNRSCVGGSGDHPGSLHVPQFLRNFFTHAERLCRDAPCSSFEKLASCRLVGL… |
| U6L5W1 | 3-271 | None |
| A0A2J7PZ22 | 33-265 | None |
| A0A182FBK8 | 831-1077 | None |
| A0A7R9KC60 | 209-446 | None |
| A0A151H2C2 | 1-235 | None |
| D3PZ98 | 173-398 | None |
| A0A0R3T9X4 | 3-221 | None |
| A0A2P8YE00 | 92-334 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.