DPCstruct | MC15391
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 116 ± 25 aa |
| Standard deviation of domain lengths | 24.94 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 72.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 22.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P8DZU0 | 6-116 | KLALHETLHNLNQNICYTTRLSRTSYEDLVEMVSHLNQLCITTFEEQCSFVKFALKKQQENLFWRLSTKVFCRISKKNRSIYRTFEL… |
| A0A368GL70 | 16-123 | ATSSLYNDVTWTSFLEMIKELNRKCFHVRNEKGDYICFALDKSCTDGFMWKKLARIKCFTVNLDSLQVTSSRVLRLEEFLNVYSVHK… |
| A0A3Q4HQQ2 | 40-115 | None |
| A0A2M4BSS5 | 1-141 | None |
| A0A0V1D363 | 31-112 | None |
| A0A816VCQ4 | 13-161 | None |
| A0A814HQT9 | 15-156 | None |
| A0A1I8CWV9 | 1-92 | None |
| A0A3S2MAG3 | 454-588 | None |
| A0A498S8B5 | 11-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.