DPCstruct | MC15390
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 79 ± 13 aa |
| Standard deviation of domain lengths | 12.99 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 43.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183IUG5 | 391-451 | FYVYDSLPSCSPRTPTCRSPYVFCDVRQYVCVSKVVPGGNCQGFEGTDICYHSTCVRGTCV |
| A0A368GL07 | 22-100 | YSYSPRPSCSMGNNCGSKYLYCDRSHGQPRCASKIKPGGSCAGLSNGEDACYNGRCQGERCVAQSTQATPPPPIAPTKP |
| A0A3P6S036 | 268-339 | None |
| A0A0R3QQ18 | 505-586 | None |
| A0A6V7U0V9 | 110-185 | None |
| A0A0B1PI26 | 189-258 | None |
| A0A0D6MD13 | 304-383 | None |
| A0A1I7VBE6 | 1-69 | None |
| A0A0D6M8N7 | 82-187 | None |
| A0A0K0DWB1 | 413-479 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.