DPCstruct | MC15389
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 92 ± 12 aa |
| Standard deviation of domain lengths | 12.32 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 46.65 |
| Pfam Score | 92.40 |
| Assigned Pfam label(s) | CL0023- CL0357- CL0181 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1PZU3 | 366-451 | SAIKYGELIILGYNGHLPSGDKGRKKSKFILGKKPSGNGVKPFRKHVVKNAQAAKALQDPQSHSVTYTLSRHQAVVVEYKQDEDTD |
| A0A368GKS5 | 42-131 | KYGELILLGYNGSQDSRATVPLKRHRTKMALMRRKNGNGIKKGSVTQVNIAAKDAPAVLDKNRHVVSYSYGKNQTVLVEYVADPFKD… |
| A0A183H5E5 | 141-236 | None |
| A0A4Z2FTS8 | 6-101 | None |
| A0A4C1VC99 | 55-145 | None |
| A0A7J7VJL7 | 17-124 | None |
| A0A7R9P9Z9 | 22-124 | None |
| A0A060ZAT7 | 22-134 | None |
| A0A654H2D3 | 5-91 | None |
| A0A0K2UQJ0 | 22-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.