DPCstruct | MC15386
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 168 ± 17 aa |
| Standard deviation of domain lengths | 16.50 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368GKC1 | 1-162 | MGALRMDDEEPLGVAQVLKPDPRSYDAAAELKRALGKAFKDSAPIVNRSHRNFHGGGKIVKQKYTWPPVRNIGLSMELDREEGEVKW… |
| A0A067SJM0 | 31-171 | DGEAEMRRFFGSRVVQANRAEQSSSRRKAPAVKSNLTRPQPTWWAAKGREGLSLRALSDEETNEKLKRQGWTPMQEKWWTVEYSKKY… |
| A0A3P7I9J8 | 102-261 | None |
| U6KBQ9 | 147-320 | None |
| M7BXK7 | 684-860 | None |
| A0A507EP78 | 120-287 | None |
| A0A183TWB9 | 377-542 | None |
| A0A183RZW4 | 102-261 | None |
| A0A2G9UXW1 | 2-165 | None |
| A0A0L0SSV3 | 234-366 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.