DPCstruct | MC15384
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 189 ± 11 aa |
| Standard deviation of domain lengths | 11.38 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 21.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B9W7L5 | 338-513 | AAFAERLRSLLVVFVPASNDGGYEPSRSVLPPATPAAMRVSFEGDVRRARELEHIDAAGAVAAYRRLVAAQPGFAETHFRLARLLEG… |
| A0A351I5J8 | 4-164 | LAHQAGAKIAFCALPANLRDSVPTTGASLPWDQPDFFSAWTAWEEEDAARAVRLFAARVASVPGDPHAHYWLARALDMVGRTREAAR… |
| A0A5C5Z7F0 | 250-443 | None |
| A0A2E7M855 | 552-744 | None |
| A0A7C4HML3 | 213-419 | None |
| A0A2D5ZI74 | 43-223 | None |
| A0A2E8AZP3 | 199-390 | None |
| A0A848XQH0 | 242-440 | None |
| A0A2E6EJA3 | 378-579 | None |
| A0A7Z9KUU2 | 116-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.