DPCstruct | MC15381
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 151 ± 19 aa |
| Standard deviation of domain lengths | 19.10 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 16.87 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | PF18076- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A855HEZ8 | 2-134 | FIVAGAPAHSSFKKAQLLTRLSSISSVQTFDSQWVYLFDQALDEQQHQSALQLLNDGTSFELRQVANDELQVLVTPRIGTISPWSSK… |
| A0A2A4TVK6 | 20-171 | KNLIEVVPKIGVTDVPGEAALRQLPLLDIKTVREVRISTIYEVTGKYSSSHINQIARELLADPITQEYKVERSATPNAFLMGPHVRV… |
| A0A3S9H5B3 | 5-167 | None |
| A0A6C1RV81 | 2-167 | None |
| A0A3A9STN1 | 4-161 | None |
| A0A087CAL0 | 2-149 | None |
| A0A7E4RDR1 | 2-151 | None |
| A0A2R7Q8U5 | 55-173 | None |
| A0A2G9LQ86 | 64-203 | None |
| A0A0G0GAX1 | 1-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.