DPCstruct | MC1538
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 58 ± 5 aa |
| Standard deviation of domain lengths | 5.00 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 47.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V7X9P1 | 13-70 | RPGDFESLQASVLFCNRCRAPQPVRERLLLVLPDGELNEYLCAACGASVGSRKVTAPP |
| A0A3M1VFU8 | 20-70 | YRQFSASELFCPVCRQAMPVRERLLLVLPDGREVYDYVCRSCGESLGRKEG |
| A0A3N5QAG8 | 9-64 | None |
| A0A7C1N7B5 | 2-55 | None |
| A0A7V2GC47 | 2-66 | None |
| A0A2V6F462 | 3-58 | None |
| A0A7X7QSH3 | 11-68 | None |
| A0A7X9FP04 | 3-60 | None |
| A0A2G4I833 | 1-56 | None |
| A0A1W9MJT3 | 16-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.