DPCstruct | MC15379
Metacluster Properties and Pfam Annotations
| Number of structural domains | 155 |
|---|---|
| Mean domain length (aa) | 243 ± 39 aa |
| Standard deviation of domain lengths | 38.54 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 21.07 |
| Pfam Score | 99.39 |
| Assigned Pfam label(s) | PF04784- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A522Q1J5 | 21-240 | KVDTAPWNEILRQYVNQQHLVDYSKLKQQDWKKLREFVGDLGHQGSQESSPDEIKALLINAYNSMTMEWIIENYPVQSIWDTQTPFK… |
| A0A7S0WSY2 | 8-225 | RDFQEAICEFQRVDIQGLDHNAKLAFFINLYNLVVLHAFTELGVPTSSIQRSKYFDEAKYIVGGFTLSLTDIENGILRANRKAPYHF… |
| A0A081BP45 | 367-623 | None |
| A0A287XGE1 | 4-230 | None |
| F6GU27 | 399-680 | None |
| A0A7S2UF35 | 972-1237 | None |
| A0A535A8A3 | 14-235 | None |
| A0A563W4K6 | 1-162 | None |
| B0EQD1 | 480-726 | None |
| A0A7S4P3K2 | 82-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.