DPCstruct | MC15377
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 53 ± 4 aa |
| Standard deviation of domain lengths | 4.46 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 62.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I7N079 | 34-83 | VNGVIPWNPYVVNCNLQPRPPRVRGSAPDAGAIIACRDRPGCLAWYINGP |
| A0A502EDA1 | 2-56 | NIVPYDPYHQTCGIPNQIPTAPGQAPGAGAIIACRNIPGCLSQAVNGPQLVSVPQ |
| G7CK80 | 50-99 | None |
| A0A100WE50 | 24-73 | None |
| A0A5C7MRP7 | 3-57 | None |
| A0A5C7WU52 | 1-50 | None |
| A0A2M9FKK7 | 1-50 | None |
| A0A2N8LRM8 | 1-64 | None |
| A0A318H710 | 25-83 | None |
| A0A7W5SUT8 | 29-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.