DPCstruct | MC15372
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 145 ± 14 aa |
| Standard deviation of domain lengths | 13.78 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 23.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A132B8T5 | 1-139 | MEKSKEASVEKCRDGKEGQKSASANAKSYKGLLKSLARMRQQPNRHEELASKTSQWTWTNKQCREWITAVSVWYLGYDEVDGEKAAA… |
| A0A2J6QZL4 | 18-160 | QSPPPAYEDGSTAGTSLANSAPSISPSSSTTPKPRKSLATFLRPFAKRIRAADTPQWAWSNVQCREWLAAVLVEYCNRDPVVARELA… |
| A0A2V1BHL9 | 34-191 | None |
| A0A132B8D5 | 61-208 | None |
| A0A194X9J2 | 2-145 | None |
| A0A194X1J6 | 1-135 | None |
| S3DV27 | 2-111 | None |
| A0A7D8YNB7 | 26-184 | None |
| A0A4Z1KYM6 | 19-172 | None |
| A0A2J6RH68 | 89-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.