DPCstruct | MC15371
Metacluster Properties and Pfam Annotations
| Number of structural domains | 192 |
|---|---|
| Mean domain length (aa) | 199 ± 35 aa |
| Standard deviation of domain lengths | 35.21 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.05 |
| Pfam Score | 82.47 |
| Assigned Pfam label(s) | CL0023- PF01031- PF02212- PF19434 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4Y6A4 | 69-267 | QTFPDDYAKATTALVTKYLNKPDTLVLCVVDATIPSLDSSTALAMIRAADKLPNTILALTKSDLVRSEIEIVERIFDRVLGSSSDNQ… |
| A0A2J6QYV3 | 2-202 | KLVKTMVESYIKDERTIIAEKALNKGIRTLGVLTNPDLIDPGTGGKVMSLVRGEKNHLKLGYYALRNRGKLQESSSSEELDTPESEF… |
| A0A6P8VA34 | 6-153 | None |
| A0A4W4FKC2 | 66-317 | None |
| A0A6A5UVD4 | 43-226 | None |
| A0A1V6RZ76 | 95-317 | None |
| A0A0G4HVK8 | 182-454 | None |
| A0A3P7LLX1 | 11-137 | None |
| A0A7R9A5X6 | 33-249 | None |
| J4UD84 | 229-498 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.