DPCstruct | MC15370
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 71 ± 9 aa |
| Standard deviation of domain lengths | 8.83 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 47.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9LQ58 | 2-70 | VHGKVYDSARAGGAAAGALFWQLLAEGMDSYGDGYEVVLGRAPSTTGVIATQSRRLKVLARSFVRARKV |
| A0A3Q7J573 | 2-68 | SSVYRNVYNLAKEGGTMEGSLVWQLMAHGMENYDDGYSIVLGLNPSTTQIISNQAHIMTALAHSLNH |
| A0A7J7DLB5 | 120-186 | None |
| A0A059BTD2 | 91-156 | None |
| A0A7J6XD00 | 95-160 | None |
| A0A2I0A016 | 168-237 | None |
| A0A484KAF3 | 94-163 | None |
| A0A427A3M7 | 356-429 | None |
| A0A061FJW3 | 31-96 | None |
| A0A287T9D3 | 1-59 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.