DPCstruct | MC15368
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 68 ± 3 aa |
| Standard deviation of domain lengths | 3.48 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 82.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 71.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05758 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P6G4J3 | 81-149 | EEQSKKEEQRRIEIAETWDSFLFAQIIRGFILVTQSILRKYIILPLLIIIKNSIRIVLFQLPEWEEDLK |
| A0A5D2NZ09 | 1-63 | MRIEIAEAWDSLLLAQVIRGSVLITQSILRKYIILPSLIIVKNIARMLLFQFPEWSEDLTDWN |
| A0A5D2ZWD8 | 1-63 | None |
| A0A830D793 | 105-175 | None |
| A0A4Y7ITG4 | 510-580 | None |
| A0A0H3W2S4 | 413-482 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.