DPCstruct | MC15367
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 163 ± 29 aa |
| Standard deviation of domain lengths | 29.36 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 73.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0367 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q7I8R1 | 1-227 | MSVTHHTIKLNKSKMEGKRIKLSHVLAFLLLASLFQTLMARDLISDGIEVLQLPVENDGEFVFCPGKQSWPELVGKSARYAKQVIQK… |
| T1EQY6 | 8-155 | LMCLATTNAMIAVPDGFQLAEKSWPELKDKKMLDVKQAILKDMPNIGFREFPVDASKYSEEFWYNEVKLVYDKSNNVVEVPAYWGIE… |
| A0A813ZTG7 | 1-164 | None |
| A0A2R6X999 | 60-201 | None |
| A0A438E3Z6 | 1-152 | None |
| A0A7J6GW81 | 10-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.