DPCstruct | MC15366
Metacluster Properties and Pfam Annotations
| Number of structural domains | 80 |
|---|---|
| Mean domain length (aa) | 76 ± 11 aa |
| Standard deviation of domain lengths | 10.70 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 39.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02320 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q7I5P6 | 68-143 | LRLEYLFAMSDEEVVDPKATLEVSCKPKCVRQLKEYQACTKRIEGDESGHKHCTGQYFDYWHCIDKCVAAKLFDHL |
| M1AT49 | 2-55 | EVSCKPKCVRQLKDYQACTRRIEGDESGSKHCTGQYFDYWQCIDKCVAPKLFEK |
| A0A2G8L697 | 9-92 | None |
| L5K327 | 11-91 | None |
| A0A4Z2HVS8 | 7-93 | None |
| T1N720 | 1-59 | None |
| A0A1D2NFH7 | 26-83 | None |
| A0A654E9X8 | 57-133 | None |
| A0A5P1F4P0 | 84-147 | None |
| A0A821PQ67 | 8-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.