DPCstruct | MC15361
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 188 ± 32 aa |
| Standard deviation of domain lengths | 32.32 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 15.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W6CL85 | 111-298 | FGTLETRVDESIDGDRATGTWFTYKINISFTPDTAVVNADEIAFIQTVRLVETASGCNKDPEATNQKRQTPSATSVDRLSGKKQGWY… |
| A0A1G0RYB9 | 24-216 | KKINPCGSFTFTGVANDGAASNGITMNLRFSFDPALCGSDCNTTTICYIQMVRTFDFSEGTYSYISEEHEARAIEYGWYIDRLTGRN… |
| B1FMM4 | 1-217 | None |
| A0A5C1AJE4 | 2-187 | None |
| A0A1A9HSS3 | 33-281 | None |
| A0A1F5QPK4 | 28-231 | None |
| A0A376C0G8 | 64-222 | None |
| A1ZNE1 | 223-419 | None |
| G2Z5M7 | 61-227 | None |
| A0A7V4UBQ8 | 40-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.