DPCstruct | MC1536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 497 ± 66 aa |
| Standard deviation of domain lengths | 65.72 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y3APM9 | 15-588 | SVRQTEDYQETLEENWKLWNNLPETDDSYIKISSLDDGIGVMSSLLLKQNNYMSMAGGDGACMGCGEKTTIHLLLSTVNAFMAPRVE… |
| A0A3M0ZP68 | 3-522 | ESKGVEELLTSVYSGLCEKRCVALKEMIAAKISSLRELIESEEKKRALLSDESRLKKAVGGFGEASVNISSIKDVLHKGEAGRVMPE… |
| A0A7X6ZLB4 | 580-1019 | None |
| A0A7Y2CUM0 | 81-632 | None |
| A0A521UFC7 | 705-1266 | None |
| A0A1F8L0U7 | 2-407 | None |
| A0A2E8H1Z3 | 585-1183 | None |
| A0A3C0XF47 | 69-568 | None |
| A0A848VKP4 | 458-845 | None |
| A0A661MMZ6 | 3-480 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.