DPCstruct | MC15359
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 104 ± 11 aa |
| Standard deviation of domain lengths | 10.69 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 69.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H0GA34 | 7-113 | AQQQEVPNATLILVFGILSIVFCFCYGVLGLVFGILSVVFANKSSRLYKQNPNIYTLGSYKNMQAGKICGIIGLSLSALFIVIVLIY… |
| A0A839AN79 | 3-105 | KEQLPNSTIIIILGVLSILGSCCFGGALGLIMGITALILAKKAKNTYNETPELYEGLSNVNTGKILAIIGIILSLIIIAMVIFIGMY… |
| A0A368MC38 | 2-115 | None |
| A0A7V3CV23 | 1-93 | None |
| A0A5M6CFT4 | 3-116 | None |
| A0A3G6MKK4 | 2-85 | None |
| A0A7T9GPY7 | 14-110 | None |
| A0A1F3KS10 | 2-88 | None |
| A0A7L5G0B7 | 31-147 | None |
| A0A1Z8BB14 | 1-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.