DPCstruct | MC15358
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 119 ± 16 aa |
| Standard deviation of domain lengths | 15.50 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 68.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L2ANK4 | 1-126 | MVFAENGNATGCTGKPKRSPHGSRLPDDWAPSEGDVLYATQQGVDGRYEAEKFRDYWRSVAGAKGRKQDWEATWRNWIRRAAEDKTS… |
| A0A7L5ARH2 | 1-89 | MLDVDAPAPKPKASTAHGTRLPEDWQPPPDLVAWTRAECPAAATDREVEKFRDYWLSTPGARGRKASWTRTWKTWARRCQDDADARQ… |
| A0A336NGT3 | 25-159 | None |
| A0A4Q9GK46 | 106-227 | None |
| A0A364NVS2 | 109-209 | None |
| A0A2N9AHH1 | 5-132 | None |
| E6Z1F1 | 178-293 | None |
| A0A5N1K3F4 | 1-127 | None |
| A0A2R4E7N6 | 159-272 | None |
| H0FZ31 | 87-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.