DPCstruct | MC15354
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 102 ± 8 aa |
| Standard deviation of domain lengths | 7.82 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10094 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M0WX93 | 119-232 | SYLYPMMTEIYERHQKPLAFIEIGASAGLQLGMDQYNYCYNQQLRINNSNSAFVLSSENRGEPLPASISNAPVVCQRVGIDLNPIDI… |
| A0A2N8FLV6 | 2-99 | RSAALMLGLIEIARRHGPRLELLEIGSSAGLNLLIDRYRFDLGGSFYGPEHSPVTITPVWSGPPAPVVPLEMVSVRGCDVQPLDATD… |
| A0A354W0V1 | 116-218 | None |
| A0A1S2PP86 | 2-91 | None |
| A0A535EUG4 | 217-332 | None |
| A0A7W5B4D3 | 96-201 | None |
| A0A3B0S8I6 | 10-113 | None |
| U4V8F7 | 1-95 | None |
| A0A2W2EMW3 | 517-617 | None |
| A0A418VUI5 | 243-356 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.