DPCstruct | MC15353
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 87 ± 14 aa |
| Standard deviation of domain lengths | 13.86 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 93.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0143 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X1DBY9 | 43-112 | VLMEPKFGFESGNIGAGAPLIETERGWLMIFHCVEDSNKGKIYHASAALLDKRDPHKVIGRLKEHLFYQL |
| A0A7V3I3B7 | 52-159 | NGKYAMLSRPSDNGHTPFGDIFYSESPDLTYWGRHRWVMGRRGAWESTKIGAGPVPIETTEGWLLIYHGVLTSCNGYVYHAGAAILD… |
| A0A0N0JJS8 | 283-373 | None |
| A0A7W8UE72 | 1-61 | None |
| B0K2D3 | 48-147 | None |
| A0A0K2RMC7 | 115-200 | None |
| A0A7Y3CQG6 | 206-296 | None |
| A0A0B4N017 | 141-223 | None |
| A0A7J3I2P7 | 91-159 | None |
| A0A523SFR1 | 416-511 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.