DPCstruct | MC15351
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 95 ± 16 aa |
| Standard deviation of domain lengths | 15.92 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 90.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0227 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S4KE03 | 228-320 | PKIKHVRAWFIGGATAEQGAGGGDYHDQGANHWIDDHIATPMSKYKQYEQSRQSFGINVLGTLIVEVEADNGQTGFAVSTAGEMGCF… |
| A0A2N8F5V8 | 1-85 | PKIKHVRAFVVRGGGADYHDQGTGHWIDDHIATPMSRYPEYRQSRQSFGINVLGTLVVELEADDGTIGFAVTTGGEPAAYIVEKH |
| A0A6G1KM34 | 14-101 | None |
| A0A812VLA9 | 7-107 | None |
| A0A1G4AZY2 | 7-85 | None |
| N2J544 | 2-86 | None |
| A0A0F7SXK2 | 62-149 | None |
| A0A402ARY6 | 1-74 | None |
| A0A3D9VAS9 | 166-300 | None |
| A0A537P7G4 | 46-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.