DPCstruct | MC1535
Metacluster Properties and Pfam Annotations
| Number of structural domains | 80 |
|---|---|
| Mean domain length (aa) | 157 ± 20 aa |
| Standard deviation of domain lengths | 19.74 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M0ZN20 | 4-160 | FKDKLKWAWRGAADASGVTTSVGLGDLGDPLLGTDYALCIYDSVAGTPQFVASFEVPGGTAAWKPKNLIGFSFKDKVGDMSDGIRRV… |
| A0A2V7DQY3 | 1-119 | MPFASFVARVELEKREFKLKGTFTLGARSNGIHPLTEDVTLQVGAFAATIPAGSLRSHGHDTFRFEGVARGAALEVEIRSRGGGRFE… |
| A0A534ZGE6 | 33-187 | None |
| A0A534WKY7 | 2-129 | None |
| A0A534ZDT0 | 2-116 | None |
| A0A534ZAK0 | 877-1049 | None |
| A0A534Z8W2 | 661-796 | None |
| A0A534Z7L0 | 4-148 | None |
| A0A2V7U1V9 | 175-300 | None |
| A0A534WEU8 | 383-549 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.