DPCstruct | MC15349
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 84 ± 14 aa |
| Standard deviation of domain lengths | 13.54 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 23.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9PAS7 | 2-68 | QFQKLGGVIRDKEKVTDITPGPVVTVSTSAGVYRTKSLVITAGPWANKLLSHIGLQLPLEVQKINVC |
| A0A2N8F4I9 | 6-80 | ALHAHYLAQARQGGVTLLLSAPLQRALHTGGRWQMETGAGPVSATILVNAAGAWADAVAEMAGVAPIGIAAYRRT |
| A0A6L5DFQ3 | 420-491 | None |
| A0A7H0F1L2 | 38-108 | None |
| A0A3A9U171 | 33-136 | None |
| A0A5A8C661 | 116-181 | None |
| A0A377AJ89 | 6-100 | None |
| A0A371XMZ0 | 13-97 | None |
| A0A534ZUY5 | 57-128 | None |
| A0A447QRU6 | 102-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.