DPCstruct | MC15348
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 73 ± 9 aa |
| Standard deviation of domain lengths | 8.50 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 51.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0052 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N8EXT6 | 2-63 | EASANGTVAAIGSGGNYALSAARALVDYEADAETICRKAMAIAAEVCVYTNDRLTVESLAAS |
| A0A7W1QU13 | 1-75 | IANPHGIFGVAAHRTVQEYSKFYALGSGGDYALGALYSSYGDPAKSAEDLARHAIVTAAEFDDGTALPVLSHSIK |
| U6KKI8 | 30-99 | None |
| A0A1C3YA73 | 89-156 | None |
| A0A1E5KWG4 | 105-175 | None |
| A0A655QFJ2 | 10-77 | None |
| A0A0G4GXZ1 | 140-231 | None |
| D2VK69 | 176-249 | None |
| A0A7Y2JUW1 | 32-101 | None |
| A0A418ASL6 | 48-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.