DPCstruct | MC15346
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Standard deviation of domain lengths | 4.79 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 94.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 52.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E1E1L4 | 1-71 | MSVIQGALNANGHVFLLNPNGVLFTQSAQVNVGGIVASTLHMKTEDFMAGRYTFEGAGSGTIVNQGNITAA |
| A0A2N8EL77 | 1-80 | TEPDPSSILGTLNANGQVFLINPNGILFGKGAQVNVGGLVASTLGLSDKDFMAGRYTFSGDSSAAVLNKGTLSADGGYVA |
| A0A3S0SFZ3 | 4-73 | None |
| A0A3R7W7L6 | 136-216 | None |
| A0A523QBY0 | 132-199 | None |
| A0A2N2U9B8 | 122-199 | None |
| A3JIN8 | 16-93 | None |
| A0A7W9DGN0 | 240-310 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.