DPCstruct | MC15342
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 88 ± 9 aa |
| Standard deviation of domain lengths | 9.39 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 60.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S8DXG4 | 3-101 | ELSPEESEDVLFKEPHHISLQAWLTYFWRRAKVYGVEVEKADERLNFWNSRSGQAPTSHDAVDVEQGLIELRKLEIERRLWESRRDI… |
| A0A1S4BWF4 | 23-100 | ELSPEESEDVLFKEAWLTYFWRRAKAHGIQEDKANKRLQFWSSRSGHAPTSHDAVDVEQGLMELRKLGIEQKLWESSR |
| A0A7N0UYS9 | 103-195 | None |
| A0A5D2DF08 | 53-157 | None |
| A0A835RFY4 | 175-267 | None |
| A0A6A2YXH7 | 299-395 | None |
| A0A6P6FXD9 | 621-715 | None |
| A0A453HP64 | 39-123 | None |
| A0A453HPX1 | 145-227 | None |
| A0A7J9GWC0 | 2-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.