DPCstruct | MC1534
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 86 ± 10 aa |
| Standard deviation of domain lengths | 10.07 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 37.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0500 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7XCQ4 | 1-78 | MKSIAVIVVLLVSLISSGCKTGSYRERGTGLGAVGGALAGAAIGEHNDRPLAGAAIGTAIGALAGSAIGDSMDQDMEQ |
| A0A3M0ZFW4 | 30-120 | WTAVGLAVVTLAVAGCASGPLTKREQGAATGAAIGAGTGAIIGSTRGDAFEGAVIGGALGALGGALVGDQVQAEEQRTESLEERARR… |
| A0A7X9FU60 | 3-111 | None |
| A0A3M2BEL7 | 1-82 | None |
| A0A7X8CB76 | 1-89 | None |
| A0A518CKN9 | 54-133 | None |
| A0A354T8T1 | 1-76 | None |
| A0A410P6E9 | 137-215 | None |
| A0A534V1E3 | 1-105 | None |
| A0A838QW34 | 1-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.