DPCstruct | MC15336
Metacluster Properties and Pfam Annotations
| Number of structural domains | 160 |
|---|---|
| Mean domain length (aa) | 176 ± 43 aa |
| Standard deviation of domain lengths | 43.43 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 80.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 15.59 |
| Pfam Score | 98.72 |
| Assigned Pfam label(s) | CL0190- CL0350 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538ITU2 | 3-123 | LHGIQLGRPIDLLLDRDARRAVGLDVFCGDEVHRFLPLPTAAVGRAEIRILSPLVLLEQRELDFYRSRTLALSRLRGAPVERNGRRL… |
| A0A7K3ZJS7 | 2-170 | ATRTLDQFYGMEVATMDAFLMGSVFDLRYNTKDWKVAGLMVRGSKRVMSEAPSSASGSAILLKPGRFVMNDICIVPDRMDRAIREIT… |
| A0A7X1PBB3 | 21-276 | None |
| A0A3D4ZWR2 | 1-167 | None |
| A0A168NQC1 | 6-142 | None |
| A0A838L2X1 | 57-203 | None |
| A0A4Q6G284 | 32-215 | None |
| A0A316KGD2 | 5-213 | None |
| A0A3R8Q2L7 | 2-195 | None |
| K8F337 | 235-395 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.