DPCstruct | MC15334
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 97 ± 9 aa |
| Standard deviation of domain lengths | 8.94 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 48.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U1R0X4 | 2-84 | FFVGLGDAVMPTVLVASAAFFSPAPSLGVPFVPGLNLPALLGMAGTFLGLAILLRMVFAGEAHAGLPLLNGGTIAGYLLGSVA |
| A0A7J3U6E9 | 1-89 | EEGLGEERDALFMGLGDVIIPGILASASYFYGSLYVAMAAIVGSLAGFFFLMNMAAKGNPQAGLPCLNGGAIAGYAISSYLLFGKLL… |
| A0A7J4U369 | 164-268 | None |
| A0A833DGA3 | 142-236 | None |
| A0A7J4KHX3 | 110-195 | None |
| A0A7J4T3E5 | 38-142 | None |
| A0A7M4AW45 | 1-105 | None |
| A0A6V8E089 | 362-466 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.