DPCstruct | MC15330
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 107 ± 8 aa |
| Standard deviation of domain lengths | 8.03 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 51.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0143 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D4KQQ8 | 14-112 | MIVEAIGANGRYFRSFTASSLSGSWTPQASSESNPFAGKANSGATWTNDISHGDLVRNNPDQTMTVDPCNLQFLYQGKSPSAGGPYD… |
| A0A1V2RHF3 | 1-109 | MVIEGIGSDGKRYFNSWTADSLDAVGDEWAPLAATESTPFLRHNNVTFAPGAEPWTSDFSHGELIRASNDQTLTIDPCNLQFLYQGK… |
| A0A146HW54 | 211-327 | None |
| A0A1V6DMJ7 | 474-581 | None |
| A0A6A6GG71 | 58-157 | None |
| A0A5C5YU46 | 154-258 | None |
| A0A2E8CWQ6 | 167-257 | None |
| G0S6F6 | 216-328 | None |
| A0A2B7XYW6 | 561-672 | None |
| A0A067C8T2 | 2-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.